SEMA7A, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SEMA7A.

Marca:  Abnova H00008482-A01.50uL

Código de producto. 16178615

Descripción

The protein encoded by this gene binds to cell surfaces through a glycosylphosphatidylinositol (GPI) linkage. The encoded glycoprotein is found on activated lymphocytes and erythrocytes. This protein may be involved in immunomodulatory and neuronal processes. Defects in this gene can result in loss of bone mineral density (BMD). Three transcript variants encoding different isoforms have been found for this gene

Sequence: EPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFIENLTAQQYGHYFCEAQEGSYFREAQHWQLLPED

Especificaciones

• Antigen: SEMA7A
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant SEMA7A.
• Gene: SEMA7A
• Gene Alias: CD108/CDw108/H-SEMA-K1/H-Sema-L/JMH/MGC126692/MGC126696/SEMAK1/SEMAL
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_003612
• Gene Symbols: SEMA7A
• Immunogen: SEMA7A (NP_003603, 536 a.a. ∼ 633 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 8482
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.