CDR2, Mouse, Clone: 4F5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CDR2.

Brand:  Abnova H00001039-M01.100ug

Product Code. 16106164

Description

Sequence: LTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWE

Specifications

• Antigen: CDR2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_001802
• Gene Symbols: CDR2
• Immunogen: CDR2 (NP_001793, 296 a.a. ∼ 404 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 4F5
• Description: Mouse monoclonal antibody raised against a partial recombinant CDR2.
• Gene: CDR2
• Gene Alias: CDR62/Yo
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 1039
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid