CAPZB, Mouse, Clone: 1H1, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CAPZB.

Brand:  Abnova H00000832-M02.100ug

Product Code. 16105644

Description

CAPZB is a member of the F-actin capping protein family. This gene encodes the beta subunit of the barbed-end actin binding protein. The protein regulates growth of the actin filament by capping the barbed end of growing actin filaments. [provided by RefSeq

Sequence: SLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC

Specifications

• Antigen: CAPZB
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_004930
• Gene Symbols: CAPZB
• Immunogen: CAPZB (NP_004921, 192 a.a. ∼ 272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 1H1
• Description: Mouse monoclonal antibody raised against a partial recombinant CAPZB.
• Gene: CAPZB
• Gene Alias: CAPB/CAPPB/CAPZ/MGC104401/MGC129749/MGC129750
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 832
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid