All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (6)
- (2)
- (4)
- (2)
- (2)
- (1)
- (3)
- (3)
- (23)
- (7)
- (14)
- (5)
- (26)
- (2)
- (24)
- (1)
- (1)
- (10)
- (6)
- (2)
- (1)
- (1)
- (1)
- (1)
- (2)
Filtered Search Results
Invitrogen™ DEGS1 Recombinant Rabbit Monoclonal Antibody (K01_1T94)
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Recombinant Monoclonal Antibody
| Content And Storage | Maintain refrigerated at 2-8°C for up to 1 month. For long term storage store at -20°C |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Liquid |
| Gene Accession No. | O15121 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | DEGS1 |
| Gene Symbols | DEGS1 |
| Regulatory Status | RUO |
| Purification Method | Protein A/G |
| Gene Alias | AA536663; Cell migration-inducing gene 15 protein; Degenerative spermatocyte homolog 1; degenerative spermatocyte homolog 1 (Drosophila); degenerative spermatocyte homolog 1, lipid desaturase; degenerative spermatocyte homolog, lipid desaturase; degenerative spermatocyte-like protein RDES; Degs; DEGS1; DEGS-1; delta 4-desaturase, sphingolipid 1; Delta(4)-desaturase; delta(4)-desaturase, sphingolipid 1; DES1; Des-1; dihydroceramide desaturase; dihydroceramide desaturase 1; dihydroceramide desaturase-1; DSH1; FADS7; fb81d06; hypothetical protein LOC507290; im:6909319; Mdes; membrane fatty acid (lipid) desaturase; membrane lipid desaturase; MGC5079; MIG15; migration-inducing gene 15 protein; MLD; sphingolipid 1; sphingolipid delta 4 desaturase; sphingolipid delta(4)-desaturase 1; sphingolipid delta(4)-desaturase DES1; wu:fa25h01; wu:fb81d06 |
| Gene | DEGS1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 8560 |
| Formulation | 50mM tris glycine with 0.05% BSA, 40% glycerol, 150mM NaCl and 0.01% sodium azide; pH 7.4 |
| Immunogen | A synthetic peptide of human MLD. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | K01_1T94 |
Invitrogen™ DEGS1 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ DEGS1 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ DEGS1 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
DEGS1 Recombinant Rabbit Monoclonal Antibody (23GB1215), Invitrogen™
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Recombinant Monoclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Isotype | IgG |
| Gene Accession No. | O15121 |
| Antigen | DEGS1 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | AA536663; Cell migration-inducing gene 15 protein; Degenerative spermatocyte homolog 1; degenerative spermatocyte homolog 1 (Drosophila); degenerative spermatocyte homolog 1, lipid desaturase; degenerative spermatocyte homolog, lipid desaturase; degenerative spermatocyte-like protein RDES; Degs; DEGS1; DEGS-1; delta 4-desaturase, sphingolipid 1; Delta(4)-desaturase; delta(4)-desaturase, sphingolipid 1; DES1; Des-1; dihydroceramide desaturase; dihydroceramide desaturase 1; dihydroceramide desaturase-1; DSH1; FADS7; fb81d06; hypothetical protein LOC507290; im:6909319; Mdes; membrane fatty acid (lipid) desaturase; membrane lipid desaturase; MGC5079; MIG15; migration-inducing gene 15 protein; MLD; sphingolipid 1; sphingolipid delta 4 desaturase; sphingolipid delta(4)-desaturase 1; sphingolipid delta(4)-desaturase DES1; wu:fa25h01; wu:fb81d06 |
| Gene | DEGS1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 8560 |
| Formulation | PBS with 50% glycerol and 0.02% sodium azide; pH 7.4 |
| Immunogen | A synthesized peptide derived from human MLD (1-53AA). |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | 23GB1215 |
Invitrogen™ DEGS1 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ DEGS1 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ DEGS1 Recombinant Rabbit Monoclonal Antibody (9D6X8)
Rabbit Recombinant Monoclonal Antibody
DEGS1, Mouse, Clone: 3F9, Abnova™
Mouse monoclonal antibody raised against a partial recombinant DEGS1.
DEGS1, Rabbit, Polyclonal Antibody, Abnova™
Rabbit polyclonal antibody raised against synthetic peptide of DEGS1.
| Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Cancer, Cardiovascular Biology, Endocrinology |
| Antigen | DEGS1 |
| Regulatory Status | RUO |
| Purification Method | Affinity purified |
| Dilution | Western Blot 1:1000-1:3000 |
| Gene Alias | Cell migration-inducing gene 15 protein, Degenerative spermatocyte homolog 1, degenerative spermatocyte homolog 1, lipid desaturase (Drosophila), degenerative spermatocyte homolog, lipid desaturase (Drosophila), DEGS, Des-1, DES1degenerative spermatocyte homolog, lipid desaturase, EC 1.14, FADS7, membrane fatty acid (lipid) desaturase, Membrane lipid desaturase, MGC5079, migration-inducing gene 15 protein, MLDdihydroceramide desaturase, sphingolipid delta 4 desaturase, sphingolipid delta(4)-desaturase DES1 |
| Gene ID (Entrez) | 8560 |
| Formulation | PBS with 50% glycerol, pH7.3. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 234-323 of human DEGS1 (NP_003667.1). YMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Content And Storage | Store at -20°C. Avoid freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Cancer, Cardiovascular Biology, Endocrinology |
| Antigen | DEGS1 |
| Regulatory Status | RUO |
| Purification Method | Ammonium sulfate precipitation |
| Dilution | Western Blot : 1-5 μg/mL |
| Gene Alias | Cell migration-inducing gene 15 protein, Degenerative spermatocyte homolog 1, degenerative spermatocyte homolog 1, lipid desaturase (Drosophila), degenerative spermatocyte homolog, lipid desaturase (Drosophila), DEGS, Des-1, DES1degenerative spermatocyte homolog, lipid desaturase, EC 1.14, FADS7, membrane fatty acid (lipid) desaturase, Membrane lipid desaturase, MGC5079, migration-inducing gene 15 protein, MLDdihydroceramide desaturase, sphingolipid delta 4 desaturase, sphingolipid delta(4)-desaturase DES1 |
| Gene ID (Entrez) | 8560 |
| Formulation | Phosphate buffered saline |
| Immunogen | Synthetic peptide derived from the human DEGS1 protein |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Content And Storage | Store at 4°C short term. Store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Cancer, Cardiovascular Biology, Endocrinology |
| Concentration | 0.3 mg/mL |
| Antigen | DEGS1 |
| Regulatory Status | RUO |
| Purification Method | Affinity purified |
| Gene Alias | Cell migration-inducing gene 15 protein, Degenerative spermatocyte homolog 1, degenerative spermatocyte homolog 1, lipid desaturase (Drosophila), degenerative spermatocyte homolog, lipid desaturase (Drosophila), DEGS, Des-1, DES1degenerative spermatocyte homolog, lipid desaturase, EC 1.14, FADS7, membrane fatty acid (lipid) desaturase, Membrane lipid desaturase, MGC5079, migration-inducing gene 15 protein, MLDdihydroceramide desaturase, sphingolipid delta 4 desaturase, sphingolipid delta(4)-desaturase DES1 |
| Gene ID (Entrez) | 8560 |
| Formulation | 50mM Tris-Glycine(pH 7.4), 0.15M NaCl, 40% Glycerol, 0.05% BSA |
| Immunogen | A synthetic peptide of human DEGS1 (Uniprot # O15121) |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | S03-5D2 |
| Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | ELISA,Western Blot |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Cancer, Cardiovascular Biology, Endocrinology |
| Antigen | DEGS1 |
| Regulatory Status | RUO |
| Purification Method | Affinity purified |
| Dilution | Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL |
| Gene Alias | Cell migration-inducing gene 15 protein, Degenerative spermatocyte homolog 1, degenerative spermatocyte homolog 1, lipid desaturase (Drosophila), degenerative spermatocyte homolog, lipid desaturase (Drosophila), DEGS, Des-1, DES1degenerative spermatocyte homolog, lipid desaturase, EC 1.14, FADS7, membrane fatty acid (lipid) desaturase, Membrane lipid desaturase, MGC5079, migration-inducing gene 15 protein, MLDdihydroceramide desaturase, sphingolipid delta 4 desaturase, sphingolipid delta(4)-desaturase DES1 |
| Gene ID (Entrez) | 8560 |
| Formulation | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human DEGS1 (NP_003667.1).,, Sequence:, MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMVLTQLGAFYIVKDLDWKWVIFGAYAFGSCINHSMTLAIHEIAHNAAFGNC |
| Classification | Monoclonal |
| Primary or Secondary | Primary |