accessibility menu, dialog, popup

UserName

Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
For Use With (Application) 
  • (4)
  • (1)
  • (1)
  • (8)
  • (4)
  • (8)
  • (8)
Form 
  • (5)
Recombinant 
  • (5)
Species 
  • (1)
  • (4)
Conjugate 
  • (1)
Keyword Search: C/8560 Clear all selections

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Selected Filters

Clear all

Keyword Search

C/8560

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

brands

  • (4)
  • (1)
  • (4)

For Use With (Application)

  • (4)
  • (1)
  • (1)
  • (8)
  • (4)
  • (8)
  • (8)

Form

  • (5)

Recombinant

  • (5)

Species

  • (1)
  • (4)

Conjugate

  • (1)
1 – 5 of 5 results
2

Abnova™ Human DEGS1 Full-length ORF (NP_003667.1, 1 a.a. - 323 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Form Liquid
Common Name DEGS1
Molecular Weight (g/mol) 64.3kDa
Gene Symbol DEGS1
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System wheat germ expression system
For Use With (Application) Antibody Production,Protein Array,ELISA,Western Blot
Name DEGS1 (Human) Recombinant Protein (P01)
Accession Number NP_003667.1
Regulatory Status RUO
Purification Method Glutathione Sepharose 4 Fast Flow
Gene Alias DEGS/DES1/Des-1/FADS7/MGC5079/MIG15/MLD
Gene ID (Entrez) 8560
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMVLTQLGAFYIVKDLDWKWVIFGAYAFGSCINHSMTLAIHEIAHNAAFGNCKAMWNRWFGMFANLPIGIPYSISFKRYHMDHHRYLGADGVDVDIPTDFEGWFFCTAFRKFIWVILQPLFYAFRPLFINPKPITYLEVINTVAQVTFDILIYYFLGIKSLVYMLAASLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag GST
Species Wheat Germ (in vitro)
Recombinant Recombinant
3

Novus Biologicals™ Recombinant Human DEGS1 GST (N-Term) Protein

Recombinant Protein

Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Gene Alias Cell migration-inducing gene 15 protein, Degenerative spermatocyte homolog 1, degenerative spermatocyte homolog 1, lipid desaturase (Drosophila), degenerative spermatocyte homolog, lipid desaturase (Drosophila), DEGS, Des-1, DES1degenerative spermatocyte homolog, lipid desaturase, EC 1.14, FADS7, membrane fatty acid (lipid) desaturase, Membrane lipid desaturase, MGC5079, migration-inducing gene 15 protein, MLDdihydroceramide desaturase, sphingolipid delta 4 desaturase, sphingolipid delta(4)-desaturase DES1
Molecular Weight (g/mol) 36.52 kDa
Gene ID (Entrez) 8560
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol DEGS1
Research Category Cancer, Cardiovascular Biology, Endocrinology
Storage Requirements Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application) Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein DEGS1
4

Novus Biologicals™ Recombinant Human DEGS1 GST (N-Term) Protein

Recombinant Protein

Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Gene Alias Cell migration-inducing gene 15 protein, Degenerative spermatocyte homolog 1, degenerative spermatocyte homolog 1, lipid desaturase (Drosophila), degenerative spermatocyte homolog, lipid desaturase (Drosophila), DEGS, Des-1, DES1degenerative spermatocyte homolog, lipid desaturase, EC 1.14, FADS7, membrane fatty acid (lipid) desaturase, Membrane lipid desaturase, MGC5079, migration-inducing gene 15 protein, MLDdihydroceramide desaturase, sphingolipid delta 4 desaturase, sphingolipid delta(4)-desaturase DES1
Molecular Weight (g/mol) MolecularWeight-theroretical: 64.3 kDa
Gene ID (Entrez) 8560
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol DEGS1
Research Category Cancer, Cardiovascular Biology, Endocrinology
Storage Requirements Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application) Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein DEGS1
5

Abnova™ Human DEGS1 Partial ORF (NP_003667, 226 a.a. - 323 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Form Liquid
Common Name DEGS1
Molecular Weight (g/mol) 36.52kDa
Gene Symbol DEGS1
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System wheat germ expression system
For Use With (Application) Antibody Production,ELISA,Protein Array,Western Blot
Name DEGS1 (Human) Recombinant Protein (Q01)
Accession Number NP_003667
Regulatory Status RUO
Gene Alias DEGS/DES1/Des-1/FADS7/MGC5079/MIG15/MLD
Gene ID (Entrez) 8560
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen SGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag GST
Species Wheat Germ (in vitro)
Recombinant Recombinant