Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
1
–
15
of
953,548
results
Separase Antibody (XJ11-1B12) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody has been used in 1 publication
| Content And Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Purified |
| Isotype | IgG1 κ |
| Gene Accession No. | Q14674 |
| Research Discipline | Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Chromatin Research, DNA Repair, Mitotic Regulators |
| Concentration | 0.9 mg/mL |
| Antigen | Separase |
| Gene Symbols | ESPL1 |
| Regulatory Status | RUO |
| Purification Method | Protein G purified |
| Dilution | Western Blot 1:500 |
| Gene Alias | Caspase-like protein ESPL1, EC 3.4.22.49, ESP1extra spindle poles like 1, extra spindle pole bodies homolog 1 (S. cerevisiae), extra spindle poles like 1 (S. cerevisiae), Extra spindle poles-like 1 protein, FLJ46492, KIAA0165separin, Separase |
| Gene ID (Entrez) | 9700 |
| Immunogen | Maltose-Binding Protein fusion of a C-terminal fragment of human Separase (residues 1866-1996). [UniProt# Q14674] |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | XJ11-1B12 |
| Purity or Quality Grade | >95%, by SDS-PAGE |
|---|---|
| Gene Alias | alpha-synuclein, I+/--synuclein, MGC110988, NACP, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, PD1, SNCA, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein |
| Gene ID (Entrez) | 6622 |
| Formulation | PBS pH 7.4 |
| Gene Symbol | SNCA |
| Research Category | Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Neurodegeneration, Neuroscience |
| Storage Requirements | Store at -80C. Avoid freeze-thaw cycles. |
| For Use With (Application) | Electron Microscopy,In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot |
| Protein | alpha-Synuclein |
| Gene Symbols | TP53BP1 |
|---|---|
| Gene Alias | 53BP1, p202, p53-binding protein 1, p53bp1, TDRD30, TP53-Binding Protein 1, tumor protein 53-binding protein, 1, tumor protein p53 binding protein 1, tumor protein p53-binding protein, 1, tumor suppressor p53-binding protein 1 |
Listeria monocytogenes p60, Mouse anti-Bacteria, Clone: p6007, Novus Biologicals™
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Bacteria |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot,ELISA |
| Form | Purified |
| Isotype | IgG1 κ |
| Concentration | 1 mg/mL |
| Antigen | Listeria monocytogenes p60 |
| Regulatory Status | RUO |
| Purification Method | Protein G purified |
| Dilution | Western Blot, ELISA |
| Gene Alias | IAP p60 from Listeria Monocytogenes, Invasion-associated Protein p60, Invasion-associated Protein p60 from Listeria Monocytogenes, invasion-associated-protein, p60 protein |
| Formulation | 0.2um-filtered solution in PBS, pH 7.4. |
| Immunogen | Recombinant Listeria monocytogenes p60. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Test Specificity | Recognizes Listeria monocytogenes p60 protein. Does not cross-react with other Listeria species. |
| Clone | p6007 |
GM130/GOLGA2 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 6 publications
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
| Isotype | IgG |
| Research Discipline | Cellular Markers, Golgi Apparatus Markers |
| Concentration | 1.0 mg/mL |
| Antigen | GM130/GOLGA2 |
| Gene Symbols | GOLGA2 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Western Blot 0.5 ug/ml, Immunohistochemistry 1:1000 - 1:1500, Immunocytochemistry/Immunofluorescence 5 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:1500 |
| Gene Alias | 130 kDa cis-Golgi matrix protein, GM130 autoantigen, GM130Golgi matrix protein GM130, golgi autoantigen, golgin subfamily a, 2, golgin A2, Golgin subfamily A member 2, golgin-95, MGC20672, SY11 protein |
| Gene ID (Entrez) | 2801 |
| Formulation | PBS with 0.02% Sodium Azide |
| Immunogen | Partial recombinant human GM130/GOLGA2 protein (amino acids 528-606). [UniPro Q08379] |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
PAK1/2/3, p Thr423, p Thr402, p Thr421 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Rat,Human,Mouse |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence |
| Isotype | IgG |
| Gene Accession No. | Q13153//Q13177//O75914 |
| Research Discipline | Apoptosis, Breast Cancer, Cancer, Neuroscience, Phospho Specific, Signal Transduction |
| Concentration | 1.0 mg/mL |
| Antigen | PAK1/2/3 (p Thr423, p Thr402, p Thr421) |
| Gene Symbols | PAK1 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Gene Alias | alpha-PAK, EC 2.7.11, EC 2.7.11.1, MGC130000, MGC130001, p21 protein (Cdc42/Rac)-activated kinase 1, p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog, yeast), p21/Cdc42/Rac1-activated kinase 1 (yeast Ste20-related), p21-activated kinase 1, p65-PAK, PAK-1, PAKalpha, serine/threonine-protein kinase PAK 1, STE20 homolog, yeast |
| Gene ID (Entrez) | 5058 |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Isotype | IgG |
| Antigen | RWDD4A |
| Gene Symbols | RWDD4 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Gene Alias | FAM28A, member A, MGC10198, Protein FAM28A, RWD domain containing 4, RWD domain containing 4A, RWD domain-containing protein 4, RWD domain-containing protein 4A, RWDD4A |
| Gene ID (Entrez) | 201965 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:EALRSIYEGDESFRELSPVSFQYRIGENGDPKAFLIEISWTETYPQTPPILSMNAFFNNTISSAVKQSILAKLQEAVEANLGTAM |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Test Specificity | Specificity of human RWDD4A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
CaMKII alpha/beta, p Thr286, p Thr287 Antibody (22B1), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 4 publications
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Purified |
| Isotype | IgG1 |
| Gene Accession No. | P11275 |
| Research Discipline | Phospho Specific, Wnt Signaling Pathway |
| Concentration | 1 mg/mL |
| Antigen | CaMKII alpha/beta (p Thr286, p Thr287) |
| Gene Symbols | CAMK2A |
| Regulatory Status | RUO |
| Purification Method | Protein G purified |
| Dilution | Western Blot 1 μg/mL, ELISA 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500, Immunoblotting |
| Gene Alias | calcium/calmodulin-dependent protein kinase (CaM kinase) II alpha, calcium/calmodulin-dependent protein kinase II alpha, calcium/calmodulin-dependent protein kinase II alpha-B subunit, CaM kinase II alpha subunit, CaM kinase II subunit alpha, CAMKAcalcium/calmodulin-dependent protein kinase type II subunit alpha, CaMK-II alpha subunit, CaMK-II subunit alpha, CaMKIINalpha, CaM-kinase II alpha chain, EC 2.7.11, EC 2.7.11.17, KIAA0968calcium/calmodulin-dependent protein kinase type II alpha chain |
| Gene ID (Entrez) | 815 |
| Immunogen | Synthetic peptide |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Test Specificity | This antibody is specific for a and B subunits of CaMKII only when they are phosphorylated at Thr-286/287 (in B). |
| Clone | 22B1 |
Bassoon Antibody (SAP7F407), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 7 publications
| Content And Storage | Store at -20C. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Rat,Mouse |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Immunofluorescence,Immunohistochemistry,Immunocytochemistry,Western Blot,Immunoprecipitation,Immunohistochemistry (Paraffin) |
| Form | Purified |
| Gene Accession No. | O88778 |
| Concentration | 1.0 mg/mL |
| Antigen | Bassoon |
| Gene Symbols | BSN |
| Regulatory Status | RUO |
| Purification Method | Protein G purified |
| Dilution | Western Blot 1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:400, Immunoprecipitation 2.5 ug, Immunohistochemistry-Paraffin 1:10-1:500, Immunohistochemistry-Frozen |
| Molecular Weight of Antigen | 400 kDa |
| Gene Alias | bassoon (presynaptic cytomatrix protein) |
| Gene ID (Entrez) | 8927 |
| Immunogen | Recombinant rat Bassoon. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Test Specificity | This affinity purified detects an ∼400 kDa protein, corresponding to the apparent molecular mass of Bassoon on SDSPAGE immunoblots, in samples from mouse and rat origins. Additional bands between 97 and 400 kDa may also be detected. |
| Clone | SAP7F407 |