accessibility menu, dialog, popup

UserName
Bio Techne logo

Bio Techne

Bio-Techne is a global developer, manufacturer, and supplier of high-quality reagents, analytical instruments, and precision diagnostics. Whether you’re at the cutting edge of academic research, translating basic discoveries into therapeutic leads, or at a facility that requires the highest level of diagnostic testing, our award-winning tools and solutions empower scientists and clinicians to achieve reproducible and consistent results. Choosing Bio‑Techne means having confidence that every solution you use will help move you towards better answers.

Top Categories

Antibodies

Antibodies are essential tools for biomedical research as they allow researchers to identify specific proteins or molecules. Our catalog of over 425,000 antibodies from our R&D Systems™ and Novus Biologicals™ brands have been validated for specificity and reproducibility in over 25 species for more than 15 applications, ensuring that you will find one for your research needs.

Find Your Antibodies
Antibodies

Cell Culture Reagents and Assays

Your unique cell cultures require a consistent foundation whether you are using classical or specialty media, sera, supplements, and matrices. Thorough cell characterization is also critical to determine if the phenotype is what you need for your particular application.

Find Your Cell Culture Reagents
Cell Culture Reagents and Assays

ELISA Kits

Have confidence in your results with R&D Systems™ rigorously validated and tested ELISA kits. As the most published ELISA supplier, with more than 30 years of experience designing and optimizing quantitative immunoassays, you can trust that you have publishable, reproducible data every time.

Find Your ELISA Kits
ELISA Kits

Fluorescent Dyes and Probes

Fluorescent and bioluminescent reagents enable highly sensitive and selective visualization of biological events, from single molecule tracking in vitro through to in vivo imaging. Discover our exclusive range of fluorescent probes, indicators, dyes, and stains.

Find Your Dyes and Probes
Fluorescent Dyes and Probes

Recombinant Proteins

Bio-Techne offers over 5,000 R&D Systems™ bioactive recombinant proteins spanning 35 species and multiple research areas. Our portfolio includes cytokines and growth factors, proteins for studying immuno-oncology targets, enzymes, and animal-free and GMP-grade proteins, as well as custom protein development services and more.

Find Your Recombinant Proteins
Recombinant Proteins

Small Molecules and Peptides

Small molecules and peptides can be used in all stages of biological and biomedical research. Bio-Techne’s unique collection of small molecules and peptides includes high quality, novel, and innovative compounds such as enzyme inhibitors, ion channel modulators, GPCR agonists and antagonists, fluorescent probes and dyes, and molecular biology tools.

Find Your Small Molecules
Small Molecules and Peptides

Related Resources

Optimizing Organoid Culture Conditions:
Optimizing Organoid Culture Conditions
An application note demonstrating the value of R&D Systems™ proteins for achieving robust, reproducible organoid culture conditions
Filename
23227_bio_techne_optimizing_organoids_Fisherised_v2.pdf
Size
1 MB
Format
application/pdf
Realize Your Protein and Cell Potential
Realize Your Protein and Cell Potential
Realize your protein and cell potential
Filename
23227_bio_techne_realize_protein_Fisherised.pdf
Size
3 MB
Format
application/pdf
Organ-on-a-Chip Technology:
Organ-on-a-Chip Technology
Progress, challenges, and an exciting future
Filename
23227_bio_techne_organ_on_a_chip_technology_progress_Fisherised.pdf
Size
326 KB
Format
application/pdf

Fisher Scientific Europe Announces a New Distribution Agreement with Bio-Techne in Europe

Paris, France 01-05-2024

 

Thermo Fisher Scientific, a leading provider of laboratory products and services, is pleased to announce a significant milestone in its commitment to providing cutting-edge solutions to its customers. Effective May 1, 2024, Thermo Fisher will enter into a strategic European distribution agreement with Bio-Techne (NASDAQ: TECH), a global life sciences company providing innovative tools and bioactive reagents for the research and clinical diagnostic communities.

This partnership marks an important collaboration between two industry leaders in the fields of scientific research, diagnostics, and biotechnology. Under this agreement, Thermo Fisher, through the Fisher Scientific channel, Europe, will distribute Bio-Techne's extensive portfolio of innovative products, including antibodies, proteins, immunoassay kits, reagents and enzymes to laboratories and research institutions across Europe.

"We are thrilled to forge this partnership with Bio-Techne, a company renowned for its pioneering advancements in the life sciences industry," said Claire Wallace, President, Fisher Scientific channel, Europe. "By adding Bio-Techne's high-quality products to our comprehensive portfolio, we aim to further empower scientists and researchers with the tools they need to drive breakthrough discoveries and advancements in healthcare."

Bio-Techne's state-of-the-art products are designed to accelerate research and improve outcomes in areas including cell and gene therapy, immunology, neuroscience, and more. With this collaboration, Thermo Fisher reinforces its commitment to providing customers with access to the latest technologies and expertise, ultimately advancing scientific knowledge and improving human health.

"We are excited to partner with Thermo Fisher to expand the reach of our products and services throughout Europe," said Kim Kelderman, Bio-Techne’s President and Chief Executive Officer. "By leveraging the Fisher Scientific Channel's extensive European distribution network and industry expertise, we aim to enhance support for researchers and accelerate scientific discoveries that address some of the most pressing challenges in healthcare today."

This distribution agreement underscores Thermo Fisher's dedication to fostering innovation and collaboration within the scientific community. Through strategic partnerships with leading companies like Bio-Techne, Thermo Fisher continues to strengthen its position as a trusted partner for researchers and laboratories across Europe.

About Bio-Techne

Bio-Techne Corporation (NASDAQ: TECH) is a global life sciences company providing innovative tools and bioactive reagents for the research and clinical diagnostic communities. Bio-Techne products assist scientific investigations into biological processes and the nature and progress of specific diseases. They aid in drug discovery efforts and provide the means for accurate clinical tests and diagnoses. With thousands of products in its portfolio, Bio-Techne generated over $1.1 billion in net sales in fiscal year 2023 and has approximately 3,100 employees worldwide.

 

Questions? Reach Out to a Specialist >

 

Risultati della ricerca filtrata

I prodotti di alcuni dei nostri fornitori non vengono visualizzati nei risultati della ricerca filtrata. Si prega di deselezionare tutti i filtri per vedere questi prodotti.

Filtra risultati

Filtra risultati

categoria

iofferte speciali

  • (1)

programmi speciali

  • (6,734)

Coniugato

  • (3)
  • (19,058)
  • (7)
  • (2,819)
  • (5)
  • (8)
  • (17)
  • (20,849)
  • (21,135)
  • (21,061)
  • (22,206)
  • (20,872)
  • (21,127)
  • (21,110)
  • (20,834)
  • (7)
  • (261)
  • (2)
  • (3)
  • (2)
  • (3)
  • (2)
  • (1)
  • (1)
  • (4)
  • (26,978)
  • (14,841)
  • (5)
  • (4)
  • (2)
  • (2)
  • (2)
  • (26,825)
  • (26,815)
  • (26,786)
  • (11)
  • (26,816)
  • (26,609)
  • (30)
  • (14)
  • (26,739)
  • (26,802)
  • (26,819)
  • (39)
  • (25,561)
  • (115)
  • (2)
  • (26,650)
  • (1)
  • (4)
  • (9,947)
  • (25,482)
  • (1,696)
  • (1,695)
  • (25,434)
  • (9,903)
  • (1)
  • (19,030)
  • (14)
  • (2,820)
  • (2,831)
  • (2,818)
  • (5)
  • (6)
  • (5)
  • (4)
  • (20,965)
  • (11)
  • (8)
  • (8)
  • (150)
  • (4)
  • (19)
  • (143)
  • (157,891)
  • (114)
  • (18,632)
  • (18,596)
  • (18,593)

Applicazioni

  • (65)
  • (133)
  • (165)
  • (18)
  • (5)
  • (464)
  • (106)
  • (5)
  • (2,165)
  • (658)
  • (1,643)
  • (121)
  • (55)
  • (72)
  • (1)
  • (8)
  • (127)
  • (42,438)
  • (2)
  • (36)
  • (114)
  • (93)
  • (1,622)
  • (366)
  • (272,504)
  • (5,623)
  • (5,512)
  • (5,582)
  • (22)
  • (59)
  • (163,524)
  • (292)
  • (7,669)
  • (3)
  • (6)
  • (309)
  • (7,319)
  • (7)
  • (43)
  • (92)
  • (4,366)
  • (69)
  • (67)
  • (6)
  • (36)
  • (3,041)
  • (1,620)
  • (121,100)
  • (51,927)
  • (337)
  • (38)
  • (162,949)
  • (341,162)
  • (651)
  • (21,536)
  • (24)
  • (278,360)
  • (18)
  • (48)
  • (22)
  • (470)
  • (43,237)
  • (52)
  • (211)
  • (53)
  • (262)
  • (97)
  • (142)
  • (7,267)
  • (99)
  • (8)
  • (6)
  • (137)
  • (5)
  • (134)
  • (967)
  • (2)
  • (10,630)
  • (1)
  • (18)
  • (3)
  • (1,320)
  • (93)
  • (6,993)
  • (324)
  • (2)
  • (3)
  • (7)
  • (444)
  • (3)
  • (7)
  • (715)
  • (4,309)
  • (135)
  • (142)
  • (2,629)
  • (75)
  • (2)
  • (22)
  • (103)
  • (11)
  • (522,478)
  • (453)
  • (15)

Target Species

  • (20)
  • (28)
  • (129)
  • (12)
  • (1,237)
  • (143)
  • (25)
  • (563)
  • (17)
  • (32)
  • (514)
  • (675)
  • (38)
  • (2,450)
  • (203)
  • (12)
  • (16,371)
  • (740)
  • (1,542)
  • (98)
  • (22)
  • (880)
  • (6)
  • (27)
  • (20,891)
  • (600)
  • (5,172)
  • (267)
  • (349)
  • (566)
  • (141)
  • (2)
  • (4)
  • (20)
  • (1,522)
  • (2)
  • (240)
  • (32)
  • (36)
  • (4)
  • (1,274)
  • (99)
  • (10)
  • (971)
  • (74)
  • (1)
  • (4)
  • (7,055)
  • (78)
  • (2)
  • (2,640)
  • (65)
  • (512)
  • (182)
  • (1)
  • (77)
  • (890)
  • (16)
  • (129)
  • (95)
  • (1,875)
  • (13)
  • (179)
  • (27)
  • (5,959)
  • (93)
  • (230)
  • (176)
  • (149)
  • (127)
  • (107)
  • (2,436)
  • (211)
  • (2)
  • (1)
  • (741,167)
  • (460)
  • (1)
  • (1)
  • (1)
  • (93)
  • (51)
  • (7)
  • (85)
  • (391)
  • (240)
  • (315)
  • (21)
  • (81)
  • (11)
  • (91)
  • (287)
  • (798)
  • (769)
  • (2)
  • (18)
  • (97)
  • (12,172)
  • (65)
  • (2)
  • (292,501)
  • (3,485)
  • (1)
  • (15)
  • (299)
  • (8)
  • (47)
  • (3,208)
  • (24)
  • (2)
  • (216)
  • (43)
  • (168)
  • (35)
  • (128)
  • (11,777)
  • (29)
  • (549)
  • (225)
  • (447)
  • (12,862)
  • (75)
  • (237)
  • (2)
  • (10,098)
  • (312)
  • (197,827)
  • (3,918)
  • (1)
  • (204)
  • (326)
  • (9)
  • (20)
  • (22)
  • (145)
  • (27)
  • (5)
  • (667)
  • (2,805)
  • (2,851)
  • (207)
  • (6)
  • (44)
  • (13)
  • (75)
  • (523)
  • (47)
  • (7)
  • (1,013)
  • (10,877)
  • (25)
  • (36)
  • (138)
  • (1,492)
  • (1,374)
  • (3,846)

Classificazione

  • (453,084)
  • (380,572)

Specie ospite

  • (956)
  • (23)
  • (8)
  • (1,466)
  • (630)
  • (17)
  • (2)
  • (23,267)
  • (44)
  • (50)
  • (420)
  • (9,337)
  • (34)
  • (30)
  • (334,992)
  • (1)
  • (28)
  • (5)
  • (415,470)
  • (30,503)
  • (15,562)
  • (1)
  • (1)

Quantità

  • (1)
  • (2)
  • (1)
  • (3,056)
  • (932)
  • (2,699)
  • (4,374)
  • (1)
  • (1)
  • (4)
  • (1)
  • (1,384)
  • (3,328)
  • (667,719)
  • (16,787)
  • (9)
  • (825)
  • (64)
  • (1)
  • (8)
  • (1)
  • (3,726)
  • (790)
  • (1,240)
  • (192)
  • (1)
  • (5)
  • (1)
  • (6,221)
  • (576)
  • (1)
  • (3)
  • (3)
  • (7)
  • (24)
  • (1)
  • (2,057)
  • (1,903)
  • (2)
  • (70)
  • (1)
  • (17)
  • (1)
  • (30)
  • (3)
  • (1)
  • (123)
  • (25,554)
  • (47,819)
  • (1)
  • (1)
  • (49)
  • (4)
  • (2)
  • (7)
  • (10)
  • (6)
  • (36)
  • (1)
  • (4)
  • (1)
  • (1)
  • (1)
  • (1)
  • (15)
  • (1)
  • (2)
  • (1)
  • (7)
  • (51)
  • (341)
  • (3,589)
  • (4,023)
  • (5)
  • (64)
  • (97)
  • (150)
  • (1)
  • (2)
  • (1)
  • (1)
  • (16,813)
  • (2,075)
  • (1)
  • (7)
  • (14)
  • (7)
  • (85)
  • (5)
  • (1)
  • (2,135)
  • (5)
  • (198)
  • (1)
  • (7)
  • (1)
  • (3)
  • (1)
  • (4)
  • (14)
  • (525)
  • (9)
  • (2)
  • (13)
  • (884)
  • (8,308)
  • (1)
  • (3)
  • (2)
  • (7)
  • (38)
  • (705)
  • (1)
  • (35)
  • (6)
  • (1)
  • (1)
  • (9)
  • (15)
  • (1)
  • (662)
  • (5)
  • (8)

Isotype

  • (99)
  • (55)
  • (25)
  • (1)
  • (43)
  • (2)
  • (2)
  • (436,329)
  • (21,258)
  • (501)
  • (140,461)
  • (60,362)
  • (752)
  • (28)
  • (50)
  • (7,233)
  • (235)
  • (1,873)
  • (124)
  • (54,410)
  • (17,617)
  • (533)
  • (35)
  • (53,469)
  • (18,189)
  • (587)
  • (4)
  • (23)
  • (570)
  • (1,862)
  • (27)
  • (1,796)
  • (1,214)
  • (44)
  • (906)
  • (153)
  • (33)
  • (430)
  • (290)
  • (33)
  • (1,071)
  • (17)

Status giuridico

  • (761,485)

Forma

  • (889)
  • (812)
  • (20)
  • (1)
  • (1)
  • (4,074)
  • (2,378)
  • (3)
  • (160)
  • (690,845)
  • (4)
  • (1)
  • (2)
  • (750)
  • (1)

Da utilizzare con (applicazione)

  • (2,709)
  • (1,920)
  • (8)
  • (2)
  • (4)
  • (2)
  • (1)
  • (1)
  • (25)
  • (305)
  • (20,281)
  • (2)
  • (4)
  • (37)
  • (48)
  • (99)
  • (1)
  • (3)
  • (30)
  • (25)
  • (7)
  • (3)
  • (10)
  • (546)
  • (19,643)
  • (8)
  • (34)
  • (20)
  • (67)
  • (235)
  • (562)
  • (9)
  • (322)
  • (16)
  • (2)
  • (78)
  • (141)
  • (88)
  • (1)
  • (68)
  • (1)
  • (11)
  • (1)
  • (4)
  • (4,210)
  • (4)
  • (3)
  • (19,551)
  • (6)
  • (1)
  • (6,280)
  • (4)
  • (2)
  • (5)
  • (1)
  • (3)
  • (1)
  • (19,922)
  • (5)
  • (1)

1 – 15 di 951,841 risultati
1

Separase Antibody (XJ11-1B12) - BSA Free, Novus Biologicals™

Mouse Monoclonal Antibody has been used in 1 publication

ID gene (immissione) 9700
Specie ospite Mouse
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Immunogeno Maltose-Binding Protein fusion of a C-terminal fragment of human Separase (residues 1866-1996). [UniProt# Q14674]
N. accesso geni Q14674
Target Species Human
Applicazioni Western Blot
Coniugato Unconjugated
Classificazione Monoclonal
Alias gene Caspase-like protein ESPL1, EC 3.4.22.49, ESP1extra spindle poles like 1, extra spindle pole bodies homolog 1 (S. cerevisiae), extra spindle poles like 1 (S. cerevisiae), Extra spindle poles-like 1 protein, FLJ46492, KIAA0165separin, Separase
Isotype IgG1 κ
Forma Purified
Antigene Separase
Metodo di purificazione Protein G purified
Simboli geni ESPL1
Status giuridico RUO
Disciplina di ricerca Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Chromatin Research, DNA Repair, Mitotic Regulators
Diluizione Western Blot 1:500
Concentrazione 0.9 mg/mL
Primario o secondario Primary
Clone XJ11-1B12
2

Novus Biologicals Recombinant Human alpha-Synuclein Active, Pre-formed Fibrils, (Type 1), A53T Mutant Protein

ID gene (immissione) 6622
Simbolo del gene SNCA
Proteine alpha-Synuclein
Purity or Quality Grade >95%, by SDS-PAGE
Alias gene alpha-synuclein, I+/--synuclein, MGC110988, NACP, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, PD1, SNCA, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein
Da utilizzare con (applicazione) Electron Microscopy,In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot
Research Category Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Neurodegeneration, Neuroscience
Formulazione PBS pH 7.4
Requisiti di stoccaggio Store at -80C. Avoid freeze-thaw cycles.
3

Novus Biologicals™ Human HBsAg ELISA Kit (Colorimetric)

ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.

4

53BP1 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Alias gene 53BP1, p202, p53-binding protein 1, p53bp1, TDRD30, TP53-Binding Protein 1, tumor protein 53-binding protein, 1, tumor protein p53 binding protein 1, tumor protein p53-binding protein, 1, tumor suppressor p53-binding protein 1
Simboli geni TP53BP1
5

RAD52 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

ID gene (immissione) 5893
Specie ospite Rabbit
Immunogeno This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSE
Target Species Human
Applicazioni Western Blot,Immunocytochemistry,Immunofluorescence,KnockDown
Coniugato Unconjugated
Classificazione Polyclonal
Alias gene DNA repair protein RAD52 homolog, RAD52 (S. cerevisiae) homolog, RAD52 homolog (S. cerevisiae), recombination protein RAD52, rhabdomyosarcoma antigen MU-RMS-40.23
Isotype IgG
Test di specificità Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigene RAD52
Metodo di purificazione Affinity Purified
Simboli geni RAD52
Status giuridico RUO
Disciplina di ricerca Breast Cancer, DNA Repair, Homologous Recombination
Diluizione Western Blot 0.04 - 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, KnockDown Validated
Primario o secondario Primary
7

GDF-15 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 9 publications

Specie ospite Rabbit
Status giuridico RUO
8

DNA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

ID gene (immissione) 1763
Specie ospite Rabbit
Immunogeno This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YLPSFCKWAGDFMHKNTSTDFPQMQLSLPSDNSKDNSTCNIEVVKPMDIEESIWSPRFGLKGKIDVTVGVKIHRGYKTKYKIMPLELKTGKESNSIEHRSQ
Target Species Human
Applicazioni Immunocytochemistry,Immunofluorescence
Coniugato Unconjugated
Classificazione Polyclonal
Alias gene DNA replication ATP-dependent helicase-like homolog, DNA replication helicase 2 homolog (yeast), DNA2 DNA replication helicase 2-like (yeast), EC 3.6.1, EC 3.6.4.12, FLJ10063, KIAA0083DNA2LDNA2-like helicase, MGC133297
Isotype IgG
Test di specificità Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigene DNA2
Metodo di purificazione Affinity Purified
Simboli geni DNA2
Status giuridico RUO
Formulazione PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Primario o secondario Primary
10

LC3B Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1218 publications

Specie ospite Rabbit
Content And Storage Store at -20°C.
Immunogeno Polyclonal LC3B Antibody was made to a synthetic peptide made to an N-terminal portion of the human LC3B protein sequence (between residues 1-100). [UniProt# Q9GZQ8]
Target Species Pig,Avian,Bacteria,Bovine,Primate,Rabbit,Zebrafish
Metodo di purificazione Affinity Purified
Isotype IgG
Simboli geni MAP1LC3B
Diluizione Western Blot 0.5 - 2.0 ug/mL, Simple Western 1:50, Flow Cytometry, ELISA, Immunohistochemistry 1:200 - 1:400, Immunocytochemistry/Immunofluorescence 1:200, Immunoprecipitation 20 ug/500 ug of protein, Immunohistochemistry-Paraffin 1:200 - 1:400, Immunohistochemistry-Frozen, Immunoblotting, Proximity Ligation Assay, SDS-Page, Chromatin Immunoprecipitation (ChIP), Knockout Validated, KnockDown Validated
11

Pannexin-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

ID gene (immissione) 24145
Specie ospite Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Immunogeno This antibody was developed against Recombinant Protein corresponding to amino acids:VLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC
Target Species Human
Applicazioni Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Coniugato Unconjugated
Classificazione Polyclonal
Alias gene MGC21309, MRS1innexin, pannexin 1, pannexin-1, PX1, UNQ2529
Isotype IgG
Test di specificità Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigene Pannexin-1
Metodo di purificazione Affinity Purified
Simboli geni PANX1
Status giuridico RUO
Formulazione PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Diluizione Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:10-1:20, Knockdown Validated
Primario o secondario Primary
12

Sirtuin 1/SIRT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 3 publications

ID gene (immissione) 23411
Specie ospite Rabbit
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Immunogeno This antibody was developed against Recombinant Protein corresponding to amino acids:IVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSD
Target Species Human
Coniugato Unconjugated
Classificazione Polyclonal
Alias gene EC 3.5.1, S. cerevisiae, homolog) 1, sirtuin 1
Isotype IgG
Test di specificità Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigene Sirtuin 1/SIRT1
Metodo di purificazione Affinity Purified
Simboli geni SIRT1
Status giuridico RUO
Formulazione PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Disciplina di ricerca Apoptosis, Chromatin Research, DNA Repair, Epigenetics, Histone Deacetylases
Primario o secondario Primary
13

Carbonic Anhydrase IX/CA9 Antibody (2D3) - BSA Free, Novus Biologicals™

Mouse Monoclonal Antibody has been used in 7 publications

ID gene (immissione) 768
Specie ospite Mouse
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Immunogeno Purified recombinant fragment of human Carbonic Anhydrase IX expressed in E. coli. [UniProt# Q16790]
N. accesso geni Q16790
Target Species Human,Mouse
Applicazioni Western Blot,Flow Cytometry,ELISA,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Coniugato Unconjugated
Peso molecolare dell'antigene 50 kDa
Classificazione Monoclonal
Alias gene CA-IX, CAIXcarbonic anhydrase 9, Carbonate dehydratase IX, carbonic anhydrase IXpMW1, carbonic dehydratase, EC 4.2.1.1, G250, Membrane antigen MN, MNRCC-associated antigen G250, P54/58N, RCC-associated protein G250, Renal cell carcinoma-associated antigen G250
Isotype IgG1
Forma Purified
Antigene Carbonic Anhydrase IX/CA9
Metodo di purificazione Protein A or G purified
Simboli geni CA9
Status giuridico RUO
Disciplina di ricerca Cancer, Cellular Markers, HIF Target Genes, Hypoxia, Lipid and Metabolism, Signal Transduction
Diluizione Western Blot 1:2000, Flow Cytometry 1:200-1:400, ELISA 1:10000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200-1:1000, Flow (Intracellular) 1 ug/mL, CyTOF-ready
Concentrazione 1.0 mg/mL
Primario o secondario Primary
Clone 2D3
14

TMC5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

ID gene (immissione) 79838
Specie ospite Rabbit
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Immunogeno This antibody was developed against Recombinant Protein corresponding to amino acids:TEGRKIMIRLLHEQIINEGKDKMFLIEKLIKLQDMEKKANPSSLVLERREVEQQGFLHLGEHDGSLDLRSRRSVQEGNPR
Target Species Human
Applicazioni Immunohistochemistry,Immunohistochemistry (Paraffin)
Coniugato Unconjugated
Classificazione Polyclonal
Alias gene FLJ13593, transmembrane channel-like 5, transmembrane channel-like protein 5
Isotype IgG
Test di specificità Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigene TMC5
Metodo di purificazione Affinity Purified
Simboli geni TMC5
Status giuridico RUO
Formulazione PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Diluizione Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Primario o secondario Primary
15

TMC5 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

ID gene (immissione) 79838
Specie ospite Rabbit
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Immunogeno Recombinant fusion protein containing a sequence corresponding to amino acids 676-760 of human TMC5 (NP_079056.2). YWQITEGRKIMIRLLHEQIINEGKDKMFLIEKLIKLQDMEKKANPSSLVLERREVEQQGFLHLGEHDGSLDLRSRRSVQEGNPRA
Target Species Human
Applicazioni Western Blot
Coniugato Unconjugated
Classificazione Polyclonal
Alias gene FLJ13593, transmembrane channel-like 5, transmembrane channel-like protein 5
Isotype IgG
Forma Purified
Antigene TMC5
Metodo di purificazione Affinity purified
Status giuridico RUO
Formulazione PBS (pH 7.3), 50% glycerol
Disciplina di ricerca Cell Biology
Diluizione Western Blot 1:500-1:2000
Primario o secondario Primary

Bio Techne