accessibility menu, dialog, popup

UserName
Bio Techne logo

Bio Techne

Bio-Techne is a global developer, manufacturer, and supplier of high-quality reagents, analytical instruments, and precision diagnostics. Whether you’re at the cutting edge of academic research, translating basic discoveries into therapeutic leads, or at a facility that requires the highest level of diagnostic testing, our award-winning tools and solutions empower scientists and clinicians to achieve reproducible and consistent results. Choosing Bio‑Techne means having confidence that every solution you use will help move you towards better answers.

Top Categories

Antibodies

Antibodies are essential tools for biomedical research as they allow researchers to identify specific proteins or molecules. Our catalog of over 425,000 antibodies from our R&D Systems™ and Novus Biologicals™ brands have been validated for specificity and reproducibility in over 25 species for more than 15 applications, ensuring that you will find one for your research needs.

Find Your Antibodies
Antibodies

Cell Culture Reagents and Assays

Your unique cell cultures require a consistent foundation whether you are using classical or specialty media, sera, supplements, and matrices. Thorough cell characterization is also critical to determine if the phenotype is what you need for your particular application.

Find Your Cell Culture Reagents
Cell Culture Reagents and Assays

ELISA Kits

Have confidence in your results with R&D Systems™ rigorously validated and tested ELISA kits. As the most published ELISA supplier, with more than 30 years of experience designing and optimizing quantitative immunoassays, you can trust that you have publishable, reproducible data every time.

Find Your ELISA Kits
ELISA Kits

Fluorescent Dyes and Probes

Fluorescent and bioluminescent reagents enable highly sensitive and selective visualization of biological events, from single molecule tracking in vitro through to in vivo imaging. Discover our exclusive range of fluorescent probes, indicators, dyes, and stains.

Find Your Dyes and Probes
Fluorescent Dyes and Probes

Recombinant Proteins

Bio-Techne offers over 5,000 R&D Systems™ bioactive recombinant proteins spanning 35 species and multiple research areas. Our portfolio includes cytokines and growth factors, proteins for studying immuno-oncology targets, enzymes, and animal-free and GMP-grade proteins, as well as custom protein development services and more.

Find Your Recombinant Proteins
Recombinant Proteins

Small Molecules and Peptides

Small molecules and peptides can be used in all stages of biological and biomedical research. Bio-Techne’s unique collection of small molecules and peptides includes high quality, novel, and innovative compounds such as enzyme inhibitors, ion channel modulators, GPCR agonists and antagonists, fluorescent probes and dyes, and molecular biology tools.

Find Your Small Molecules
Small Molecules and Peptides

Related Resources

Optimizing Organoid Culture Conditions:
Optimizing Organoid Culture Conditions
An application note demonstrating the value of R&D Systems™ proteins for achieving robust, reproducible organoid culture conditions
Filename
23227_bio_techne_optimizing_organoids_Fisherised_v2.pdf
Size
1 MB
Format
application/pdf
Realize Your Protein and Cell Potential
Realize Your Protein and Cell Potential
Realize your protein and cell potential
Filename
23227_bio_techne_realize_protein_Fisherised.pdf
Size
3 MB
Format
application/pdf
Organ-on-a-Chip Technology:
Organ-on-a-Chip Technology
Progress, challenges, and an exciting future
Filename
23227_bio_techne_organ_on_a_chip_technology_progress_Fisherised.pdf
Size
326 KB
Format
application/pdf

Fisher Scientific Europe Announces a New Distribution Agreement with Bio-Techne in Europe

Paris, France 01-05-2024

 

Thermo Fisher Scientific, a leading provider of laboratory products and services, is pleased to announce a significant milestone in its commitment to providing cutting-edge solutions to its customers. Effective May 1, 2024, Thermo Fisher will enter into a strategic European distribution agreement with Bio-Techne (NASDAQ: TECH), a global life sciences company providing innovative tools and bioactive reagents for the research and clinical diagnostic communities.

This partnership marks an important collaboration between two industry leaders in the fields of scientific research, diagnostics, and biotechnology. Under this agreement, Thermo Fisher, through the Fisher Scientific channel, Europe, will distribute Bio-Techne's extensive portfolio of innovative products, including antibodies, proteins, immunoassay kits, reagents and enzymes to laboratories and research institutions across Europe.

"We are thrilled to forge this partnership with Bio-Techne, a company renowned for its pioneering advancements in the life sciences industry," said Claire Wallace, President, Fisher Scientific channel, Europe. "By adding Bio-Techne's high-quality products to our comprehensive portfolio, we aim to further empower scientists and researchers with the tools they need to drive breakthrough discoveries and advancements in healthcare."

Bio-Techne's state-of-the-art products are designed to accelerate research and improve outcomes in areas including cell and gene therapy, immunology, neuroscience, and more. With this collaboration, Thermo Fisher reinforces its commitment to providing customers with access to the latest technologies and expertise, ultimately advancing scientific knowledge and improving human health.

"We are excited to partner with Thermo Fisher to expand the reach of our products and services throughout Europe," said Kim Kelderman, Bio-Techne’s President and Chief Executive Officer. "By leveraging the Fisher Scientific Channel's extensive European distribution network and industry expertise, we aim to enhance support for researchers and accelerate scientific discoveries that address some of the most pressing challenges in healthcare today."

This distribution agreement underscores Thermo Fisher's dedication to fostering innovation and collaboration within the scientific community. Through strategic partnerships with leading companies like Bio-Techne, Thermo Fisher continues to strengthen its position as a trusted partner for researchers and laboratories across Europe.

About Bio-Techne

Bio-Techne Corporation (NASDAQ: TECH) is a global life sciences company providing innovative tools and bioactive reagents for the research and clinical diagnostic communities. Bio-Techne products assist scientific investigations into biological processes and the nature and progress of specific diseases. They aid in drug discovery efforts and provide the means for accurate clinical tests and diagnoses. With thousands of products in its portfolio, Bio-Techne generated over $1.1 billion in net sales in fiscal year 2023 and has approximately 3,100 employees worldwide.

 

Questions? Reach Out to a Specialist >

 

Risultati della ricerca filtrata

I prodotti di alcuni dei nostri fornitori non vengono visualizzati nei risultati della ricerca filtrata. Si prega di deselezionare tutti i filtri per vedere questi prodotti.

Filtra risultati

Filtra risultati

categoria

iofferte speciali

  • (4,969)

programmi speciali

  • (6,736)

Coniugato

  • (3)
  • (19,058)
  • (7)
  • (2,819)
  • (5)
  • (8)
  • (17)
  • (20,849)
  • (21,135)
  • (21,061)
  • (22,206)
  • (20,872)
  • (21,127)
  • (21,110)
  • (20,834)
  • (7)
  • (261)
  • (2)
  • (3)
  • (2)
  • (3)
  • (2)
  • (1)
  • (1)
  • (4)
  • (26,978)
  • (14,841)
  • (5)
  • (4)
  • (2)
  • (2)
  • (2)
  • (26,825)
  • (26,815)
  • (26,786)
  • (11)
  • (26,816)
  • (26,609)
  • (30)
  • (14)
  • (26,739)
  • (26,802)
  • (26,819)
  • (39)
  • (25,561)
  • (115)
  • (2)
  • (26,650)
  • (1)
  • (4)
  • (9,947)
  • (25,482)
  • (1,696)
  • (1,695)
  • (25,434)
  • (9,903)
  • (1)
  • (19,030)
  • (14)
  • (2,820)
  • (2,831)
  • (2,818)
  • (5)
  • (6)
  • (5)
  • (4)
  • (20,965)
  • (11)
  • (8)
  • (8)
  • (150)
  • (4)
  • (19)
  • (143)
  • (157,890)
  • (114)
  • (18,632)
  • (18,596)
  • (18,593)

Applicazioni

  • (65)
  • (133)
  • (165)
  • (18)
  • (5)
  • (464)
  • (106)
  • (5)
  • (2,165)
  • (658)
  • (1,643)
  • (121)
  • (55)
  • (72)
  • (1)
  • (8)
  • (127)
  • (42,438)
  • (2)
  • (36)
  • (114)
  • (93)
  • (1,622)
  • (366)
  • (272,503)
  • (5,623)
  • (5,512)
  • (5,582)
  • (22)
  • (59)
  • (163,524)
  • (292)
  • (7,669)
  • (3)
  • (6)
  • (309)
  • (7,319)
  • (7)
  • (43)
  • (92)
  • (4,366)
  • (69)
  • (67)
  • (6)
  • (36)
  • (3,041)
  • (1,620)
  • (121,099)
  • (51,927)
  • (337)
  • (38)
  • (162,948)
  • (341,162)
  • (651)
  • (21,536)
  • (24)
  • (278,360)
  • (18)
  • (48)
  • (22)
  • (470)
  • (43,237)
  • (52)
  • (211)
  • (53)
  • (262)
  • (97)
  • (142)
  • (7,267)
  • (99)
  • (8)
  • (6)
  • (137)
  • (5)
  • (134)
  • (967)
  • (2)
  • (10,630)
  • (1)
  • (18)
  • (3)
  • (1,320)
  • (93)
  • (6,993)
  • (324)
  • (2)
  • (3)
  • (7)
  • (444)
  • (3)
  • (7)
  • (715)
  • (4,309)
  • (135)
  • (142)
  • (2,629)
  • (75)
  • (2)
  • (22)
  • (103)
  • (11)
  • (522,477)
  • (453)
  • (15)

Target Species

  • (20)
  • (28)
  • (129)
  • (12)
  • (1,237)
  • (143)
  • (25)
  • (563)
  • (17)
  • (32)
  • (514)
  • (675)
  • (38)
  • (2,450)
  • (203)
  • (12)
  • (16,371)
  • (740)
  • (1,542)
  • (98)
  • (22)
  • (880)
  • (6)
  • (27)
  • (20,891)
  • (600)
  • (5,172)
  • (267)
  • (349)
  • (566)
  • (141)
  • (2)
  • (4)
  • (20)
  • (1,522)
  • (2)
  • (240)
  • (32)
  • (36)
  • (4)
  • (1,274)
  • (99)
  • (10)
  • (971)
  • (74)
  • (1)
  • (4)
  • (7,055)
  • (78)
  • (2)
  • (2,640)
  • (65)
  • (512)
  • (182)
  • (1)
  • (77)
  • (890)
  • (16)
  • (129)
  • (95)
  • (1,875)
  • (13)
  • (179)
  • (27)
  • (5,959)
  • (93)
  • (230)
  • (176)
  • (149)
  • (127)
  • (107)
  • (2,436)
  • (211)
  • (2)
  • (1)
  • (741,167)
  • (460)
  • (1)
  • (1)
  • (1)
  • (93)
  • (51)
  • (7)
  • (85)
  • (391)
  • (240)
  • (315)
  • (21)
  • (81)
  • (11)
  • (91)
  • (287)
  • (798)
  • (769)
  • (2)
  • (18)
  • (97)
  • (12,172)
  • (65)
  • (2)
  • (292,501)
  • (3,485)
  • (1)
  • (15)
  • (299)
  • (8)
  • (47)
  • (3,208)
  • (24)
  • (2)
  • (216)
  • (43)
  • (168)
  • (35)
  • (128)
  • (11,777)
  • (29)
  • (549)
  • (225)
  • (447)
  • (12,862)
  • (75)
  • (237)
  • (2)
  • (10,098)
  • (312)
  • (197,827)
  • (3,918)
  • (1)
  • (204)
  • (326)
  • (9)
  • (20)
  • (22)
  • (145)
  • (27)
  • (5)
  • (666)
  • (2,805)
  • (2,851)
  • (207)
  • (6)
  • (44)
  • (13)
  • (75)
  • (523)
  • (47)
  • (7)
  • (1,013)
  • (10,877)
  • (25)
  • (36)
  • (138)
  • (1,492)
  • (1,374)
  • (3,846)

Classificazione

  • (453,084)
  • (380,571)

Specie ospite

  • (956)
  • (23)
  • (8)
  • (1,466)
  • (630)
  • (17)
  • (2)
  • (23,267)
  • (44)
  • (50)
  • (420)
  • (9,337)
  • (34)
  • (30)
  • (334,992)
  • (1)
  • (28)
  • (5)
  • (415,469)
  • (30,503)
  • (15,562)
  • (1)
  • (1)

Quantità

  • (1)
  • (2)
  • (1)
  • (3,056)
  • (932)
  • (2,699)
  • (4,374)
  • (1)
  • (1)
  • (4)
  • (1)
  • (1,384)
  • (3,328)
  • (667,718)
  • (16,787)
  • (9)
  • (825)
  • (64)
  • (1)
  • (8)
  • (1)
  • (3,726)
  • (790)
  • (1,240)
  • (192)
  • (1)
  • (5)
  • (1)
  • (6,221)
  • (576)
  • (1)
  • (3)
  • (3)
  • (7)
  • (24)
  • (1)
  • (2,057)
  • (1,903)
  • (2)
  • (70)
  • (1)
  • (17)
  • (1)
  • (30)
  • (3)
  • (1)
  • (123)
  • (25,554)
  • (47,819)
  • (1)
  • (1)
  • (49)
  • (4)
  • (2)
  • (7)
  • (10)
  • (6)
  • (36)
  • (1)
  • (4)
  • (1)
  • (1)
  • (1)
  • (1)
  • (15)
  • (1)
  • (2)
  • (1)
  • (7)
  • (51)
  • (341)
  • (3,589)
  • (4,023)
  • (5)
  • (64)
  • (97)
  • (150)
  • (1)
  • (2)
  • (1)
  • (1)
  • (16,813)
  • (2,075)
  • (1)
  • (7)
  • (14)
  • (7)
  • (85)
  • (5)
  • (1)
  • (2,135)
  • (5)
  • (198)
  • (1)
  • (7)
  • (1)
  • (3)
  • (1)
  • (4)
  • (14)
  • (525)
  • (9)
  • (2)
  • (13)
  • (884)
  • (8,308)
  • (1)
  • (3)
  • (2)
  • (7)
  • (38)
  • (705)
  • (1)
  • (35)
  • (6)
  • (1)
  • (1)
  • (9)
  • (15)
  • (1)
  • (662)
  • (5)
  • (8)

Isotype

  • (99)
  • (55)
  • (25)
  • (1)
  • (43)
  • (2)
  • (2)
  • (436,329)
  • (21,258)
  • (501)
  • (140,461)
  • (60,362)
  • (752)
  • (28)
  • (50)
  • (7,233)
  • (235)
  • (1,873)
  • (124)
  • (54,410)
  • (17,617)
  • (533)
  • (35)
  • (53,469)
  • (18,189)
  • (587)
  • (4)
  • (23)
  • (570)
  • (1,862)
  • (27)
  • (1,796)
  • (1,214)
  • (44)
  • (906)
  • (153)
  • (33)
  • (430)
  • (290)
  • (33)
  • (1,071)
  • (17)

Status giuridico

  • (761,484)

Forma

  • (888)
  • (812)
  • (20)
  • (1)
  • (1)
  • (4,074)
  • (2,378)
  • (3)
  • (160)
  • (690,845)
  • (4)
  • (1)
  • (2)
  • (750)
  • (1)

Da utilizzare con (applicazione)

  • (2,709)
  • (1,920)
  • (8)
  • (2)
  • (4)
  • (2)
  • (1)
  • (1)
  • (25)
  • (305)
  • (20,281)
  • (2)
  • (4)
  • (37)
  • (48)
  • (99)
  • (1)
  • (3)
  • (30)
  • (25)
  • (7)
  • (3)
  • (10)
  • (546)
  • (19,643)
  • (8)
  • (34)
  • (20)
  • (67)
  • (235)
  • (562)
  • (9)
  • (322)
  • (16)
  • (2)
  • (78)
  • (141)
  • (88)
  • (1)
  • (68)
  • (1)
  • (11)
  • (1)
  • (4)
  • (4,210)
  • (4)
  • (3)
  • (19,551)
  • (6)
  • (1)
  • (6,279)
  • (4)
  • (2)
  • (5)
  • (1)
  • (3)
  • (1)
  • (19,921)
  • (5)
  • (1)

1 – 15 di 951,843 risultati
2

Rabbit IgG Isotype Control, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 36 publications

5

Histone H2AX, p Ser139 Antibody (3F2), Novus Biologicals™

Mouse Monoclonal Antibody has been used in 6 publications

ID gene (immissione) 3014
Specie ospite Mouse
Content And Storage Store at -20°C. Avoid freeze/thaw cycles.
Immunogeno This Histone H2AX [p Ser139] Antibody (3F2) was developed against a synthetic peptide sequence surrounding phosphorylated Ser139.
N. accesso geni P16104
Target Species Human
Applicazioni Western Blot
Coniugato Unconjugated
Peso molecolare dell'antigene 15 kDa
Classificazione Monoclonal
Alias gene H2A.X, H2A/X, H2AFX
Isotype IgG1 κ
Test di specificità In Western blot this antibody detects ∼17 kDa protein representing phosphorylated H2AX in gamma irradiated HeLa cell lysate. In immunofluorescence procedures, recognizes phosphorylated H2AX in gamma irradiated HeLa cells. ELISA of phosphorylated H2AX can also be performed. Used in IHC to successfully detect H2A.X pSer140 in postnatal mouse lung section.
Forma Purified
Antigene Histone H2AX (p Ser139)
Metodo di purificazione Protein G purified
Simboli geni H2AFX
Status giuridico RUO
Disciplina di ricerca Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair, Epigenetics, Mitotic Regulators, Phospho Specific
Diluizione Western Blot 1 μg/mL, Simple Western 10 μg/mL, Flow Cytometry 1 μg 106 cells, ELISA 1:100 - 1:2000, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/Immunofluorescence 2 - 4 μg/mL, Immunohistochemistry-Paraffin 1:10 - 1:500
Concentrazione 1 mg/mL
Primario o secondario Primary
Clone 3F2
6

Novus Biologicals™ Recombinant Protein A Protein

Recombinant Protein

Peso molecolare 33.4 kDa
ID gene (immissione) 3919448
Proteine Protein A
Purity or Quality Grade >97% pure by SDS-PAGE and HPLC
Ricostituzione Dissolve in distilled water or saline.
Concentrazione di endotossine Less than 0.1 EU/ug of Protein A as determined by LAL method.
Alias gene Immunoglobulin G binding protein A, SPA, Staphylococcal protein A
Da utilizzare con (applicazione) PAGE,Bioactivity,HPLC
Research Category Epitope Tags
Formulazione Lyophilized from additive free solution.
Requisiti di stoccaggio Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles.
Concentrazione LYOPH
8

Coagulation Factor III/Tissue Factor Antibody (SN20-16), Novus Biologicals™

Rabbit Monoclonal Antibody

ID gene (immissione) 2152
Specie ospite Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Immunogeno Synthetic peptide within human Coagulation Factor III/Tissue Factor aa 30-70. (SwissProt: P13726 Human; SwissProt: P20352 Mouse; SwissProt: P42533 Rat)
Coniugato Unconjugated
Classificazione Monoclonal
Alias gene CD142, CD142 antigen, Coagulation factor III, coagulation factor III (thromboplastin, tissue factor), FLJ17960, TF, TFA, Thromboplastin, tissue factor
Isotype IgG
Forma Purified
Antigene CoagulationFactorIII/TissueFactor
Metodo di purificazione Protein A purified
Simboli geni F3
Formulazione TBS (pH7.4), 0.05% BSA, 40% Glycerol with 0.05% Sodium Azide
Disciplina di ricerca Cancer
Diluizione Western Blot 1:100-1:2000, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/Immunofluorescence 1:100-1:500, Immunohistochemistry-Paraffin 1:100-1:500
Concentrazione 1 mg/mL
Primario o secondario Primary
Clone SN20-16
9

Ferroportin/SLC40A1 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Specie ospite Rabbit
Target Species Human,Mouse,Pig,Bovine
Applicazioni Western Blot,Immunohistochemistry (Paraffin)
Antigene Ferroportin/SLC40A1
11

Separase Antibody (XJ11-1B12) - BSA Free, Novus Biologicals™

Mouse Monoclonal Antibody has been used in 1 publication

ID gene (immissione) 9700
Specie ospite Mouse
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Immunogeno Maltose-Binding Protein fusion of a C-terminal fragment of human Separase (residues 1866-1996). [UniProt# Q14674]
N. accesso geni Q14674
Target Species Human
Applicazioni Western Blot
Coniugato Unconjugated
Classificazione Monoclonal
Alias gene Caspase-like protein ESPL1, EC 3.4.22.49, ESP1extra spindle poles like 1, extra spindle pole bodies homolog 1 (S. cerevisiae), extra spindle poles like 1 (S. cerevisiae), Extra spindle poles-like 1 protein, FLJ46492, KIAA0165separin, Separase
Isotype IgG1 κ
Forma Purified
Antigene Separase
Metodo di purificazione Protein G purified
Simboli geni ESPL1
Status giuridico RUO
Disciplina di ricerca Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Chromatin Research, DNA Repair, Mitotic Regulators
Diluizione Western Blot 1:500
Concentrazione 0.9 mg/mL
Primario o secondario Primary
Clone XJ11-1B12
14

ATM Antibody (5C2), Novus Biologicals™

Mouse Monoclonal Antibody has been used in 27 publications

15

USH1C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

ID gene (immissione) 10083
Specie ospite Rabbit
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Immunogeno This antibody was developed against Recombinant Protein corresponding to amino acids:IMGKDVRLLRIKKEGSLDLALEGGVDSPIGKVVVSAVYERGAAERHGGIVKGDEIMAINGKIVTDYTLAEAEAALQKAWNQGGDWIDLVVAVCPPKEYDDE
Target Species Human,Mouse
Applicazioni Immunohistochemistry,Immunohistochemistry (Paraffin)
Coniugato Unconjugated
Classificazione Polyclonal
Alias gene AIE75, AIE-75, Antigen NY-CO-38/NY-CO-37, Autoimmune enteropathy-related antigen AIE-75, deafness, autosomal recessive 18, DFNB18, harmonin, NY-CO-37, NY-CO-38, PDZ-45, PDZ73, PDZ-73, PDZ-73/NY-CO-38, Protein PDZ-73, Renal carcinoma antigen NY-REN-3, ush1cpst, Usher syndrome 1C (autosomal recessive, severe), Usher syndrome type-1C protein
Isotype IgG
Test di specificità Specificity of human USH1C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigene USH1C
Metodo di purificazione Affinity Purified
Simboli geni USH1C
Status giuridico RUO
Formulazione PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Disciplina di ricerca Signal Transduction, Vision
Diluizione Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Primario o secondario Primary

Bio Techne