Gefilterte Suchergebnisse
Produkte von einigen unserer Lieferanten werden in den gefilterten Suchergebnissen nicht angezeigt. Bitte
deaktivieren Sie alle Filter,
um diese Produkte zu sehen.
1
–
15
von
946,859
Ergebnisse
| Gensymbole | TP53BP1 |
|---|---|
| Gen-Alias | 53BP1, p202, p53-binding protein 1, p53bp1, TDRD30, TP53-Binding Protein 1, tumor protein 53-binding protein, 1, tumor protein p53 binding protein 1, tumor protein p53-binding protein, 1, tumor suppressor p53-binding protein 1 |
Listeria monocytogenes p60, Mouse anti-Bacteria, Clone: p6007, Novus Biologicals™
Mouse Monoclonal Antibody
| Testspezifität | Recognizes Listeria monocytogenes p60 protein. Does not cross-react with other Listeria species. |
|---|---|
| Klon | p6007 |
| Form | Purified |
| Konjugat | Unconjugated |
| Isotype | IgG1 κ |
| Konzentration | 1 mg/mL |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Zusammensetzung | 0.2um-filtered solution in PBS, pH 7.4. |
| Klassifikation | Monoclonal |
| Antigen | Listeria monocytogenes p60 |
| Regulatorischer Status | RUO |
| Immunogen | Recombinant Listeria monocytogenes p60. |
| Zielspezies | Bacteria |
| Wirtsspezies | Mouse |
| Reinigungsverfahren | Protein G purified |
| Anwendungen | Western Blot,ELISA |
| Verdünnung | Western Blot, ELISA |
| Gen-Alias | IAP p60 from Listeria Monocytogenes, Invasion-associated Protein p60, Invasion-associated Protein p60 from Listeria Monocytogenes, invasion-associated-protein, p60 protein |
Rabbit IgG Isotype Control, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 36 publications
Histone H2AX, p Ser139 Antibody (3F2), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 6 publications
| Testspezifität | In Western blot this antibody detects ∼17 kDa protein representing phosphorylated H2AX in gamma irradiated HeLa cell lysate. In immunofluorescence procedures, recognizes phosphorylated H2AX in gamma irradiated HeLa cells. ELISA of phosphorylated H2AX can also be performed. Used in IHC to successfully detect H2A.X pSer140 in postnatal mouse lung section. |
|---|---|
| Klon | 3F2 |
| Form | Purified |
| Gen-Zugriffsnummer | P16104 |
| Konjugat | Unconjugated |
| Isotype | IgG1 κ |
| Gensymbole | H2AFX |
| Konzentration | 1 mg/mL |
| Primär oder sekundär | Primary |
| Molekulargewicht des Antigens | 15 kDa |
| Inhalt und Lagerung | Store at -20°C. Avoid freeze/thaw cycles. |
| Klassifikation | Monoclonal |
| Antigen | Histone H2AX (p Ser139) |
| Regulatorischer Status | RUO |
| Immunogen | This Histone H2AX [p Ser139] Antibody (3F2) was developed against a synthetic peptide sequence surrounding phosphorylated Ser139. |
| Zielspezies | Human |
| Forschungsgebiet | Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair, Epigenetics, Mitotic Regulators, Phospho Specific |
| Wirtsspezies | Mouse |
| Reinigungsverfahren | Protein G purified |
| Anwendungen | Western Blot |
| Verdünnung | Western Blot 1 μg/mL, Simple Western 10 μg/mL, Flow Cytometry 1 μg 106 cells, ELISA 1:100 - 1:2000, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/Immunofluorescence 2 - 4 μg/mL, Immunohistochemistry-Paraffin 1:10 - 1:500 |
| Gen-Alias | H2A.X, H2A/X, H2AFX |
| Gen-ID (Entrez) | 3014 |
| Zusammensetzung | Lyophilized from additive free solution. |
|---|---|
| Lagerungsbedingungen | Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles. |
| Forschungskategorie | Epitope Tags |
| Molekulargewicht | 33.4 kDa |
| Rekonstitution | Dissolve in distilled water or saline. |
| Zur Verwendung mit (Anwendung) | PAGE,Bioactivity,HPLC |
| Konzentration | LYOPH |
| Endotoxin-Konzentration | Less than 0.1 EU/ug of Protein A as determined by LAL method. |
| Gen-Alias | Immunoglobulin G binding protein A, SPA, Staphylococcal protein A |
| Protein | Protein A |
| Reinheits- oder Qualitätsgrad | >97% pure by SDS-PAGE and HPLC |
| Gen-ID (Entrez) | 3919448 |
| Testspezifität | Specificity of human KERA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
|---|---|
| Konjugat | Unconjugated |
| Isotype | IgG |
| Gensymbole | KERA |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Zusammensetzung | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Klassifikation | Polyclonal |
| Antigen | KERA |
| Regulatorischer Status | RUO |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:SRSVRQVYEVHDSDDWTIHDFECPMECFCPPSFPTALYCENRGLKEIPAIPSRIWYLYL |
| Zielspezies | Human,Mouse |
| Wirtsspezies | Rabbit |
| Reinigungsverfahren | Affinity Purified |
| Anwendungen | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Verdünnung | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200 |
| Gen-Alias | CNA2, keratocan, KTN, SLRR2BKeratan sulfate proteoglycan keratocan |
| Gen-ID (Entrez) | 11081 |
| Klon | 2F1A7 |
|---|---|
| Form | Purified |
| Konjugat | Unconjugated |
| Isotype | IgG1 |
| Gensymbole | ARHGAP42 |
| Konzentration | 1 mg/mL |
| Primär oder sekundär | Primary |
| Molekulargewicht des Antigens | 98.6 kDa |
| Klassifikation | Monoclonal |
| Antigen | ARHGAP42 |
| Immunogen | Purified recombinant fragment of human ARHGAP42 (AA: 577-719) expressed in E. Coli. |
| Wirtsspezies | Mouse |
| Reinigungsverfahren | Protein G purified |
| Anwendungen | Western Blot,ELISA |
| Verdünnung | Western Blot 1:100-1:2000, ELISA 1:100-1:2000 |
| Gen-Alias | FLJ32810, Rho GTPase activating protein 42 |
| Gen-ID (Entrez) | 143872 |